TCDB is operated by the Saier Lab Bioinformatics Group
>WP_096642402.1 hypothetical protein [Calothrix brevissima]
MASENVVKFGDTFYLKHEISGQYLASVDRGRHNWPQLSNTGKVELQLVGGKGDVDTNSYIKIRTTEQVTFNNDILGAFAD
SRDCYYYKDEYDNAKQGWRITKASGDAGKIYYGDRVRITNIFYSNQRLALDKKHPGYITTVENAGDCWILEPVFVQSVAE
PPSSTNVQPISSKSLTVFSWSVASGDPTPTGVILWTRVNPKEYDKNIPLEYEVASDESFQKIICKNNISASDFDEKTDYT
VHINLHDQLKPDNYYFYRFTYKGITSPIGRCRTLPPLDKKLNKLTLAVLTCNDYSTGYFNAFYKLAEEKVDFVIHLGDFI
YEYPQYPPGYGDIVRKDLTLENQQYPYKDPANCDRATSLQHFRHIYQTYRQDPALQKAMEQHTWIIALDDHEIADNCYWD
YENNTMGISAGESQPLHPIYENLGKDTPAARSAMLELYKNATQAWREYVPALFPKVDASKSDEYRYKLYREFRFGSLVDF
FLTDSRSFRNKPSIEPNSKASMLGKEQKNWLINGVNNSTASWRVWGNQTFLATALANELIGEIDDWHGFKAERKEILKSI
KDKETLKNGTDRNSRFVVFTGDMHTSVVAYLKTETESLQSALVSGILNTFQPGVSDLKSGTSNLASGASNLLSGDLKGAV
TDAGEGVFNLGKGALNLGLGGLKAGAEVLSEIGSGIINPKETAQNVVGTVTNSFNYDYSKLAGVEFMTPSVTSPGISEGI
LKQLESSLPVDILGILEKLSLSTDNSVHQQHSWQHKFVTGSLIKSLSPHIEHYDSRVNGYAIAEFTPEQLTWKVYRVDRT
DHDKIQGRNVSTKRAKKELVQSVKYDPNGIKLTDSLG