TCDB is operated by the Saier Lab Bioinformatics Group
>tr|X6M877|X6M877_RETFI Uncharacterized protein (Fragment) OS=Reticulomyxa filosa GN=RFI_27541 PE=4 SV=1
KKKKKKKKKKKKRELNPAFELLAGRIEEQRKTSIQIDDPSNVFVAEVDFLDNRDIFRKIGMSTAPTIVLIPPTKSRREIP
LTKFFKVIGTKYQYFFSHGKQAEDIGNWISQVSKVPLSFARKFEWPDMQYVFAGIPLVILTVAFFNLWRKHMLIYAAVSL
LVYGFVLGGGMFSYIREVPFKGSGSDVGSYISGGGRYQYALEGYILGGLNLIAGTGAFLCFNSLRKPHEHPQKWFRYLAF
LPSWIGLSIMAMGCYAILWVYTRKNGGYNMGHVGMRG