TCDB is operated by the Saier Lab Bioinformatics Group
>tr|X8BD86|X8BD86_MYCAV Uncharacterized protein OS=Mycobacterium avium subsp. avium 2285 (R) GN=I549_4750 PE=4 SV=1
MNAFLNWWDGNELWLSGLAFVLQAMVVMPIVLAVAYVTAALLDGLLGKGIALMRRARQAGGTSG