TCDB is operated by the Saier Lab Bioinformatics Group
>XP_001644016.1 hypothetical protein Kpol_1026p4 [Vanderwaltozyma polyspora DSM 70294]
MIQLEKMRKALITLSIFSLYAIIIVCAYPFFDRMKPHAIAVAWECVVAVTQDLGQLEVWGAFALHAYSTIWDVVETCKKC
KNGISDQDCQDEAKFLGWSTIITLISLGRAINWKEHGRGSVKGSADIDMNGKVSLSPNGPTMSGTQPTHYVGPQKY