TCDB is operated by the Saier Lab Bioinformatics Group
>XP_006801708.1 PREDICTED: receptor expression-enhancing protein 3-like isoform X2 [Neolamprologus brichardi]
MRCVRWMMYWIVFALYTVVETITDLSLAWFPLYYELKIAFVIWLLSPYTRGASLIYRKCLHPLLSSREREIDEYIVQAKE
RSYETMVNFGKQGLSIAATAAVTAAVKGQGAITEKLRSLSMHDLTQIDQQDDRGNQLYQYSSHSSNPAVRRSRSTDAPDG
DEYYYDQEERTDEEAEPTFSEDEAVSQKGLRRSQSVKLSRSRVRKDARYGSLKIKGKKRPALSSVNYGV