TCDB is operated by the Saier Lab Bioinformatics Group
>XP_009316030.1 hypothetical protein DQ04_18841000 [Trypanosoma grayi]
MMLLQYAVNCTILVLLITFAFSYQTPRNQERVDSRFVLASFLFGAEGKSSAEFEKEIESIEDFLEIIEDIGNAYYGAPES
SSGAFMHYVYGKDNSTPVAPLLEISLYEGYYGSSARSTVLHEKFDILEENPLGPFANPNSLINESEPCDPQRDADGSYFI
PCRASAIGELFDRLICVKLSFSFFSLVRSQDGRPQPRVWFAEFLFELSGHGSVMVMKVSLDSVEKRVPERLPVMISFALL
PLVAMGFLLRIRTFPRFSAPIKQLLRMQPNPSSERHSRFCFDTRTGEGGWRWLGFISDMLTLSFSITSLVAQHMHRTDTA
VEQAVTILLGFATLVHCARLVSILKLFPSLYVVFNGIVTAGRQLSMYGLAVFPILFGYSVCGTAVFGAYGRYFSTVPLSI
ISLFCATFGDNLIDTFLEMDQSPFLLQLLFSRFFIMTYLLFFICNVLNVAHSIIQDSYTYAVRMYMAARREGNNAGRSAA
NMNTEELSNMLEKMRG