TCDB is operated by the Saier Lab Bioinformatics Group
>XP_014239154.1 uncharacterized protein LOC106674453 [Cimex lectularius]
MSRGGRGGRAAVASQSTVSTLGVSLSTSTVGAEMSESSEDDEWPVSSFWLEHILSDYHGSRVTVRDYHLAQKESALSDIL
SVSVTYAHGPDEEVTCTQRDLVLKLLPRDPFSRFFVTEAQFDLREIKFYTKIAPELHEFQKDYLIEPEKSIELPIPQCYH
ARYSGSGDSPVESVLVLENLKSSGYEVMEFARGLTLDQAKSALEAVAKLHALSLAMKVKEDIPLDKKYPFLFQTARATDS
YQQLVERGLPQLAQFLETRPGHAAVMEALISMKNDTKELISSLLTPREPMALITHTDFWCNNLLFRSDNSCKILDWQMVT
YSRPTNDVALLIVSSVPTELRRRHTNTLLDHYWGKFTELSKLLNIDIEITLSYTKGDLTADFKRSQLLALLLCIGSVDVA
LGDPVTEQRLLDLLQDLHDEGILSKDIV