TCDB is operated by the Saier Lab Bioinformatics Group
>XP_015464654.1 hypothetical protein AC631_05684 [Debaryomyces fabryi]
MRFLSITQLLILASTFLTISSSAISRDEFNDKTIQKRDFPKHDLAQTFQNVWNSGLPVRQMTLWGAFTYYGSKSTFGLID
QCNLCIANHQDPPGTNCQDSLEGLARNLAATVMAGIGIAYTNGWLGKREDFYLRAILMVLLTFLLVMISMLLIMRLLTIT
LMITIITIYWLIIMNQNIASNETRSISVQ