TCDB is operated by the Saier Lab Bioinformatics Group
>XP_015819244.1 PREDICTED: small integral membrane protein 6-like [Nothobranchius furzeri]
MVSVLEQPSRPGSFDDLAELFLHRLQQEPWALGGFVVMVVFVLGVLSLVLFALLYGRCHDTQERTQERKKELRDNAAI