TCDB is operated by the Saier Lab Bioinformatics Group
>XP_024183151.1 uncharacterized protein At5g65660 [Rosa chinensis]
MESQDLSPPHVDASRPSLGFPLGTALLLIIIFSLSGVFSCCYHWDKLRSLRRSFSENSTPETSDDIEGQSPSKSKPAHLD
LNQNQNQSVPVIMPGDQIPKFMALPCPREPPREEKIVVKVQKPPKPPRFPVPLY