TCDB is operated by the Saier Lab Bioinformatics Group
>YP_009222254.1 Mg2+ transporter protein [Lactobacillus phage LfeInf]
MQQLYKIRSTHEIENIKGGDYDWLEITKPDDSDLSLVQKRTGLEISTSKLILSSHESSHIEGLTEPDKPLMIVLQYPKMV
ESNLGDFKEYATSPIILILSNDGDNNDLITISNHEPSFIAKIQEDSKSLKVPITNKKDIMLLVIYYMSQEYRSILRSLNK
DANSLEQSLKTATNNIIFYHVMSIQKTVSSFLDSLANNQNICEKIENDANYFASEKYTELARSASLALEETSEAARHLDY
ILDKYTSLVSSIVGNNQLVTINKFTEWGIVLSFLSASFGALGMNYYLPGESSHVTTILVFATIFASSIWLSKYIRKLLKG
KK