TCDB is operated by the Saier Lab Bioinformatics Group
>gi|168703499|ref|ZP_02735776.1| hypothetical protein GobsU_28460 [Gemmata obscuriglobus UQM 2246]
MRYVRSLLGVGALLVGAGGAAAQPGAFPGAGERAPGGAPSAPVSAPASLPPVSTVPPGTAP AAPVRSLAALSDDHLPVK
DLTPHGGFGDIHPPADHGHHEVSGALNAVVPSHGGWYVSAEY LLMRPRTSDLDFAVRNTAATGLATTGPIDSLKYQLGS
GIRAGLGYVFDGGKWEATFQYTY HTAGGDSTVFAPAAAANPAANTVPSSAVLFPTLTRPGLTDRALSATATADLDYQLF
DMAA GRRFVISDNLAVRALAGFRFADIRQTFNAFYDGSDARRAAVKTRSRFEGFGPTLGAEGTL AAEYGFHLYARGQF
GFLSGRSTNQVLETNDSGATTYVNVRNDTQREVPFGTVALGLGWQY RTIALRAGYEVTHWQDIFSRPRFTDDVGQGKVI
NRPSSLSLEGLFIQASVIY