TCDB is operated by the Saier Lab Bioinformatics Group
TRANSPORTERS FROM HUMANS:
Transporter Information:
Name: ATPase, Na+/K+ transporting, beta 1 polypeptide
Symbol: ATP1B1
TC: 3.A.3.1.1
Enzyme: 3.6.1.37
Locations: 1q22-q25
Swiss-Prot: P05026
Accession Number: NM_001677
GDBGDB:120557
LocusLink481
OMIM182330
>sp|P05026|AT1B1_HUMAN Sodium/potassium-transporting ATPase subunit beta-1 OS=Homo sapiens GN=ATP1B1 PE=1 SV=1
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQI
PQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCS
GLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPL
QYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS