TCDB is operated by the Saier Lab Bioinformatics Group
TRANSPORTERS FROM HUMANS:
Transporter Information:
Name: ATPase, H+/K+ exchanging, beta polypeptide
Symbol: ATP4B
TC: 3.A.3.1.2
Enzyme: 3.6.1.36
Locations: 13q34
Aliases: ATP6B
Swiss-Prot: P51164
Accession Number: NM_000705
GDBGDB:136045
LocusLink496
OMIM137217
>sp|P51164|ATHB_HUMAN POTASSIUM-TRANSPORTING ATPASE BETA CHAIN (PROTON PUMP BETA CHAIN) (GASTRIC H+/K+ ATPASE BETA SUBUNIT) - Homo sapiens (Human).
MAALQEKKTCGQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLYVLMQTVDPYTPDYQDQLRSP
GVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQ
NCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPH
YSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK