TCDB is operated by the Saier Lab Bioinformatics Group
TRANSPORTERS FROM HUMANS:
Transporter Information:
Name: ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C, isoform 1
Symbol: ATP6V1C1
TC: 3.A.2.2.3
Enzyme: 3.6.1.34
Locations: 8p22-q21.3
Aliases: ATP6D, VATC, Vma5
GenBank: X69151
Swiss-Prot: P21283
Accession Number: NM_001695
Old Name: ATPase, H+ transporting, lysosomal (vacuolar proton pump) 42kD
GDBGDB:229110
LocusLink528
OMIM603097
PubMed (8250920): van Hille B, Vanek M, Richener H, Green JR, Bilbe G. Cloning and tissue distribution of subunits C, D, and E of the human vacuolarH(+)-ATPase.Biochem Biophys Res Commun. 1993 Nov 30;197(1):15-21. PMID: 8250920 [PubMed - indexed for MEDLINE]

The vacuolar proton ATPase (V-ATPase) translocates protons into intracellular organelles or across the plasma membrane of specialised cells such as osteoclast and renal intercalated cells. The catalytic site of the V-ATPase consists of a hexamer of three A subunits and three B subunits which bind and hydrolyse ATP and are regulated by accessory subunits C, D and E. cDNAs encoding subunits C, D, and E were cloned from human osteoclastoma, a tissue highly enriched in osteoclasts, as a first step in the characterisation of the V-ATPase used by the osteoclast. By Northern blot analysis only one mRNA species were detected for each of these subunits, which is consistent the constant transcription level in all tissues irrespective of the presence of specialised cells highly enriched in V-ATPases.

>P21283|VATC1_HUMAN Vacuolar ATP synthase subunit C 1 - Homo sapiens (Human).
MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVL
EDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGS
LLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHK
ARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAML
LQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK