TCDB is operated by the Saier Lab Bioinformatics Group
TRANSPORTERS FROM HUMANS:
Transporter Information:
Name: solute carrier family 17 (sodium phosphate), member 1
Symbol: SLC17A1
TC: 2.A.1.14.6
Locations: 6p23-p21.3
Aliases: NAPI-1
Swiss-Prot: Q14916
Accession Number: NM_005074
GDBGDB:141889
LocusLink6568
OMIM182308
PubMed (8288239): Chong SS, Kristjansson K, Zoghbi HY, Hughes MR. Molecular cloning of the cDNA encoding a human renal sodium phosphate transportprotein and its assignment to chromosome 6p21.3-p23.Genomics. 1993 Nov;18(2):355-9. PMID: 8288239 [PubMed - indexed for MEDLINE]

Resorption of phosphate by the kidney is an important function in the maintenance of phosphate homeostasis in mammals, and a defect in renal phosphate uptake has been implicated in at least three human genetic disorders. We have isolated a cDNA encoding a human sodium-dependent phosphate transport protein (NPT1). This cDNA hybridizes to a single 2.5-kb RNA transcript from human kidney cortex, its nucleotide sequence shows 80.3% identity to the rabbit NaPi-1 sequence, and it encodes a polypeptide of 467 amino acids. Amino acid sequence comparisons indicate a 69.7% identity between human NPT1 and rabbit NaPi-1 polypeptides; the inclusion of conservative substitutions increases the homology between the two proteins to 81.5%. Alignment of both sequences also reveals several conserved potential N-glycosylation and protein kinase C phosphorylation sites. Polypeptide hydropathy analysis predicts several membrane-spanning domains. This cDNA maps the location of the gene encoding NPT1 to human chromosome 6q21.3-p23.

>sp|Q14916|NPT1_HUMAN Sodium-dependent phosphate transport protein 1 OS=Homo sapiens GN=SLC17A1 PE=2 SV=2
MQMDNRLPPKKVPGFCSFRYGLSFLVHCCNVIITAQRACLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNWSPDIQ
GIILSSTSYGVIIIQVPVGYFSGIYSTKKMIGFALCLSSVLSLLIPPAAGIGVAWVVVCRAVQGAAQGIVATAQFEIYVK
WAPPLERGRLTSMSTSGFLLGPFIVLLVTGVICESLGWPMVFYIFGACGCAVCLLWFVLFYDDPKDHPCISISEKEYITS
SLVQQVSSSRQSLPIKAILKSLPVWAISTGSFTFFWSHNIMTLYTPMFINSMLHVNIKENGFLSSLPYLFAWICGNLAGQ
LSDFFLTRNILSVIAVRKLFTAAGFLLPAIFGVCLPYLSSTFYSIVIFLILAGATGSFCLGGVFINGLDIAPRYFGFIKA
CSTLTGMIGGLIASTLTGLILKQDPESAWFKTFILMAAINVTGLIFYLIVATAEIQDWAKEKQHTRL