TCDB is operated by the Saier Lab Bioinformatics Group
TRANSPORTERS FROM HUMANS:
Transporter Information:
Name: solute carrier family 22 (organic cation transporter), member 1
Symbol: SLC22A1
TC: 2.A.1.19.1
Locations: 6q26
Aliases: OCT1
GenBank: U77086
Swiss-Prot: O15245
Accession Number: NM_003057
GDBGDB:9806341
LocusLink6580
OMIM602607
PubMed (9605850): Koehler MR, Wissinger B, Gorboulev V, Koepsell H, Schmid M. The two human organic cation transporter genes SLC22A1 and SLC22A2 are locatedon chromosome 6q26.Cytogenet Cell Genet. 1997;79(3-4):198-200. PMID: 9605850 [PubMed - indexed for MEDLINE]

Polyspecific transporters for organic cations (OCT) belong to a new protein family which also include organic anion transporters. The first human transporters from this family (OCT1, OCT2) have been recently cloned. They translocate small cations like tetraethylammonium, choline and monoamine neurotransmitters and are involved in hepatic and renal cation excretion, respectively. We have localized the OCT1 and OCT2 genes (SLC22A1, SLC22A2) on chromosome 6q26.

>sp|O15245|S22A1_HUMAN Solute carrier family 22 member 1 OS=Homo sapiens GN=SLC22A1 PE=1 SV=2
MPTVDDILEQVGESGWFQKQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQRCGWSPAEELNYTVPGLGPA
GEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFL
FGSLGVGYFADRFGRKLCLLGTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMY
QMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIKIMDHIAQKNGKLPPADLKML
SLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTDSVLYQGLILHMGATSGNLYLDFLYSALVEIPGAFIALITIDRV
GRIYPMAMSNLLAGAACLVMIFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIIT
PFIVFRLREVWQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKENTIYLKVQTSEPSGT