TCDB is operated by the Saier Lab Bioinformatics Group
TRANSPORTERS FROM HUMANS:
Transporter Information:
Name: solute carrier family 22 (organic cation transporter), member 14
Symbol: SLC22A14
TC: 2.A.1.19.7
Locations: 3p22-p21.3
Aliases: OCTL2
GenBank: AB011082
Swiss-Prot: Q9Y267
Accession Number: NM_004803
Old Name: organic cationic transporter-like 4
LocusLink9389
OMIM604048
PubMed (10072596): Nishiwaki T, Daigo Y, Tamari M, Fujii Y, Nakamura Y. Molecular cloning, mapping, and characterization of two novel human genes,ORCTL3 and ORCTL4, bearing homology to organic-cation transporters.Cytogenet Cell Genet. 1998;83(3-4):251-5. PMID: 10072596 [PubMed - indexed for MEDLINE]

Through a large-scale sequencing of genomic DNA at 3p22-->p21.3, we have isolated two human genes (ORCTL3 alias OCTL1 and ORCTL4 alias OCTL2) encoding novel members of the family of organic-cation transporter molecules. The predicted proteins revealed the highest similarities to recently- isolated organic-cation transporter proteins, rat OCT-1r, rat NLT and mouse NKT. The transcripts of both genes were expressed ubiquitously in various human tissues, but some tissue-specific transcripts were also observed in kidney, testis, or skeletal muscle. The two genes are clustered within a 52-kb region of genomic DNA and ORCTL4 lies about 27 kb telomeric to ORCTL3 in the genomic DNA sequence in a tail-to-head orientation.

>sp|Q9Y267|S22AE_HUMAN Solute carrier family 22 member 14 OS=Homo sapiens GN=SLC22A14 PE=2 SV=4
MAGEENFKEELRSQDASRNLNQHEVAGHPHSWSLEMLLRRLRAVHTKQDDKFANLLDAVGEFGTFQQRLVALTFIPSIMS
AFFMFADHFVFTAQKPYCNTSWILAVGPHLSKAEQLNLTIPQAPNGSFLTCFMYLPVPWNLDSIIQFGLNDTDTCQDGWI
YPDAKKRSLINEFDLVCGMETKKDTAQIMFMAGLPIGSLIFRLITDKMGRYPAILLSLLGLIIFGFGTAFMNSFHLYLFF
RFGISQSVVGYAISSISLATEWLVGEHRAHAIILGHCFFAVGAVLLTGIAYSLPHWQLLFLVGGILVIPFISYIWILPES
PRWLMMKGKVKEAKQVLCYAASVNKKTIPSNLLDELQLPRKKVTRASVLDFCKNRQLCKVTLVMSCVWFTVSYTYFTLSL
RMRELGVSVHFRHVVPSIMEVPARLCCIFLLQQIGRKWSLAVTLLQAIIWCLLLLFLPEGEDGLRLKWPRCPATELKSMT
ILVLMLREFSLAATVTVFFLYTAELLPTVLRATGLGLVSLASVAGAILSLTIISQTPSLLPIFLCCVLAIVAFSLSSLLP
ETRDQPLSESLNHSSQIRNKVKDMKTKETSSDDV