TCDB is operated by the Saier Lab Bioinformatics Group
TRANSPORTERS FROM HUMANS:
Transporter Information:
Name: solute carrier family 25 (mitochondrial carrier; dicarboxylate transporter), member 10
Symbol: SLC25A10
TC: 2.A.29.2.2
Locations: 17q25.3
Swiss-Prot: Q9UBX3
Accession Number: NM_012140
GDBGDB:9862909
LocusLink1468
OMIM606794
PubMed (9733776): Fiermonte G, Palmieri L, Dolce V, Lasorsa FM, Palmieri F, Runswick MJ,Walker JE. The sequence, bacterial expression, and functional reconstitution of the ratmitochondrial dicarboxylate transporter cloned via distant homologs in yeast andCaenorhabditis elegans.J Biol Chem. 1998 Sep 18;273(38):24754-9. PMID: 9733776 [PubMed - indexed for MEDLINE]

The dicarboxylate carrier (DIC) belongs to a family of transport proteins found in the inner mitochondrial membranes. The biochemical properties of the mammalian protein have been characterized, but the protein is not abundant. It is difficult to purify and had not been sequenced. We have used the sequence of the distantly related yeast DIC to identify a related protein encoded in the genome of Caenorhabditis elegans. Then, related murine expressed sequence tags were identified with the worm sequence, and the murine sequence was used to isolate the cDNA for the rat homolog. The sequences of the worm and rat proteins have features characteristic of the family of mitochondrial transport proteins. Both proteins were expressed in bacteria and reconstituted into phospholipid vesicles where their transport characteristics closely resembled those of whole rat mitochondria and of the rat DIC reconstituted into vesicles. As expected from the role of the DIC in gluconeogenesis and ureogenesis, its transcripts were detected in rat liver and kidney, but unexpectedly, they were also detected in rat heart and brain tissues where the protein may fulfill other roles, possibly in supplying substrates to the Krebs cycle.

>sp|Q9UBX3|DIC_HUMAN Mitochondrial dicarboxylate carrier OS=Homo sapiens GN=SLC25A10 PE=1 SV=2
MAAEARVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALRVVRTDGILALYSGLSASLCRQMTYSLTRFA
IYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRL
FSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLSDNIFTHFVASFIAGGCATFLCQPLDVLKTRLMNSKGEYQGVFHC
AVETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKNFGIKVPS