TCDB is operated by the Saier Lab Bioinformatics Group
TRANSPORTERS FROM HUMANS:
Transporter Information:
Name: solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11
Symbol: SLC25A11
TC: 2.A.29.2.1
Locations: 17p13.3
Aliases: OGC
GenBank: X66114
Swiss-Prot: Q02978
Accession Number: NM_003562
GDBGDB:9865057
LocusLink8402
OMIM604165
PubMed (1457818): Iacobazzi V, Palmieri F, Runswick MJ, Walker JE. Sequences of the human and bovine genes for the mitochondrial 2-oxoglutaratecarrier.DNA Seq. 1992;3(2):79-88. PMID: 1457818 [PubMed - indexed for MEDLINE]

The oxoglutarate carrier transports 2-oxoglutarate across the inner membranes of mitochondria in an electroneutral exchange for malate or other dicarboxylic acids. The sequences of its human and bovine genes have been determined from overlapping genomic clones generated by polymerase chain reactions by use of primers and probes based on the bovine cDNA sequence. The bovine and human genes are split into 6 and 8 exons, respectively, and five introns are found in the same positions in both genes. The coding and protein sequences are 93% and 96.6% identical, respectively. The human oxoglutarate carrier protein is 314 amino acids in length and, in common with the bovine protein, does not appear to have a processed presequence to help to target it into mitochondria.

>sp|Q02978|M2OM_HUMAN Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens GN=SLC25A11 PE=1 SV=3
MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGI
YTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRG
YKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPV
DIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRLFLSG