TCDB is operated by the Saier Lab Bioinformatics Group
TRANSPORTERS FROM HUMANS:
Transporter Information:
Name: solute carrier family 25 (mitochondrial carrier, brain), member 14
Symbol: SLC25A14
TC: 2.A.29.2.1
Locations: Xq24
Aliases: BMCP1
GenBank: AF078544
Swiss-Prot: O95258
Accession Number: NM_003951
GDBGDB:9954769
LocusLink9016
OMIM300242
PubMed (9852133): Sanchis D, Fleury C, Chomiki N, Goubern M, Huang Q, Neverova M, Gregoire F,Easlick J, Raimbault S, Levi-Meyrueis C, Miroux B, Collins S, Seldin M, RichardD, Warden C, Bouillaud F, Ricquier D. BMCP1, a novel mitochondrial carrier with high expression in the centralnervous system of humans and rodents, and respiration uncoupling activity inrecombinant yeast.J Biol Chem. 1998 Dec 18;273(51):34611-5. PMID: 9852133 [PubMed - indexed for MEDLINE]

We report here the cloning and functional analysis of a novel homologue of the mitochondrial carriers predominantly expressed in the central nervous system and referred to as BMCP1 (brain mitochondrial carrier protein-1). The predicted amino acid sequence of this novel mitochondrial carrier indicates a level of identity of 39, 31, or 30%, toward the mitochondrial oxoglutarate carrier, phosphate carrier, or adenine nucleotide translocator, respectively, and a level of identity of 34, 38, or 39% with the mitochondrial uncoupling proteins UCP1, UCP2, or UCP3, respectively. Northern analysis of mouse, rat, or human tissues demonstrated that mRNA of this novel gene is mainly expressed in brain, although it is 10-30-fold less expressed in other tissues. In situ hybridization analysis of brain showed it is particularly abundant in cortex, hippocampus, thalamus, amygdala, and hypothalamus. Chromosomal mapping indicates that BMCP1 is located on chromosome X of mice and at Xq24 in man. Expression of the protein in yeast strongly impaired growth rate. Analysis of respiration of total recombinant yeast or yeast spheroplasts and in particular of the relationship between respiratory rate and membrane potential of yeast spheroplasts revealed a marked uncoupling activity of respiration, suggesting that although BMCP1 sequence is more distant from the uncoupling proteins (UCPs), this protein could be a fourth member of the UCP family.

>sp|O95258|UCP5_HUMAN Brain mitochondrial carrier protein-1 (BMCP-1) (Mitochondrial uncoupling protein 5) (UCP 5) (Solute carrier family 25, member 14) - Homo sapiens (Human).
MGIFPGIILIFLRVKFATAAVIVSGHQKSTTVSHEMSGLNWKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFK
EIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIAN
PTDVLKIRMQAQGSLFQGSMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFV
SSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQL
KRLQI