TCDB is operated by the Saier Lab Bioinformatics Group
TRANSPORTERS FROM HUMANS:
Transporter Information:
Name: solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4
Symbol: SLC25A4
TC: 2.A.29.1.1
Locations: 4q35
Aliases: T1
Swiss-Prot: P12235
Accession Number: NM_001151
GDBGDB:119680
LocusLink291
OMIM103220
PubMed (1582253): Fan YS, Yang HM, Lin CC. Assignment of the human muscle adenine nucleotide translocator gene (ANT1) to4q35 by fluorescence in situ hybridization.Cytogenet Cell Genet. 1992;60(1):29-30. PMID: 1582253 [PubMed - indexed for MEDLINE]

The human muscle adenine nucleotide translocator gene (ANT1) was previously assigned to chromosome 4. The gene has now been further localized to the long arm of chromosome 4 at 4q35 by fluorescence in situ hybridization. This result confirms the previous assignment and precisely maps the gene to a specific chromosome band.

>sp|P12235|ADT1_HUMAN ADP,ATP carrier protein, heart/skeletal muscle isoform T1 (ADP/ATP translocase 1) (Adenine nucleotide translocator 1) (ANT 1) - Homo sapiens (Human).
MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIR
YFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDC
IIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMM
QSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV