TCDB is operated by the Saier Lab Bioinformatics Group
TRANSPORTERS FROM HUMANS:
Transporter Information:
Name: solute carrier family 2 (facilitated glucose transporter), member 9
Symbol: SLC2A9
TC: 2.A.1.1.13
Locations: 4p16-p15.3
Aliases: Glut9, GLUTX
GenBank: AF210317
Swiss-Prot: Q9NRM0
Accession Number: NM_020041
GDBGDB:10796994
LocusLink56606
OMIM606142
PubMed (10860667): Phay JE, Hussain HB, Moley JF. Cloning and expression analysis of a novel member of the facilitative glucosetransporter family, SLC2A9 (GLUT9).Genomics. 2000 Jun 1;66(2):217-20. PMID: 10860667 [PubMed - indexed for MEDLINE]

Several lines of evidence suggest the existence of additional members of the mammalian facilitative glucose transporter family. A human cDNA sequence corresponding to a novel member of the glucose transporter family (GLUT1-5) was identified (GLUT9; HGMW-approved symbol SLC2A9), and it encodes a putative transporter of 540 amino acids. The predicted protein has sequence identity of 44 and 38% to Glut5 and Glut1, respectively. Based on hydropathic analysis, the novel transporter's predicted topology consists of 12 transmembrane domains, similar to the other family members. Northern analysis reveals three mRNA species: a major transcript of 1.9 kb and two other transcripts of 3.1 and 5.0 kb, found primarily in kidney and liver, but present at low levels in several other tissues. GLUT9 was localized to chromosome 4 using a monochromosomal human/rodent somatic cell hybrid mapping panel. A portion of the GLUT9 cDNA is represented in a National Center for Biotechnology Information UniGene cluster, which maps to chromosome 4p15.3-p16.

>sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens GN=SLC2A9 PE=1 SV=1
MARKQNRNSKELGLVPLTDDTSHARPPGPGRALLECDHLRSGVPGGRRRKDWSCSLLVASLAGAFGSSFLYGYNLSVVNA
PTPYIKAFYNESWERRHGRPIDPDTLTLLWSVTVSIFAIGGLVGTLIVKMIGKVLGRKHTLLANNGFAISAALLMACSLQ
AGAFEMLIVGRFIMGIDGGVALSVLPMYLSEISPKEIRGSLGQVTAIFICIGVFTGQLLGLPELLGKESTWPYLFGVIVV
PAVVQLLSLPFLPDSPRYLLLEKHNEARAVKAFQTFLGKADVSQEVEEVLAESRVQRSIRLVSVLELLRAPYVRWQVVTV
IVTMACYQLCGLNAIWFYTNSIFGKAGIPLAKIPYVTLSTGGIETLAAVFSGLVIEHLGRRPLLIGGFGLMGLFFGTLTI
TLTLQDHAPWVPYLSIVGILAIIASFCSGPGGIPFILTGEFFQQSQRPAAFIIAGTVNWLSNFAVGLLFPFIQKSLDTYC
FLVFATICITGAIYLYFVLPETKNRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP