TCDB is operated by the Saier Lab Bioinformatics Group
TRANSPORTERS FROM HUMANS:
Transporter Information:
Name: solute carrier family 35 (CMP-sialic acid transporter), member A1
Symbol: SLC35A1
TC: 2.A.7.12.1
Locations: 6
Aliases: CMPST, hCST
GenBank: D87969
Swiss-Prot: P78382
Accession Number: NM_006416
Old Name: solute carrier family 35 (UDP-galactose transporter), member 1
GDBGDB:9957657
LocusLink10559
OMIM605634
PubMed (9010752): Ishida N, Miura N, Yoshioka S, Kawakita M. Molecular cloning and characterization of a novel isoform of the humanUDP-galactose transporter, and of related complementary DNAs belonging to thenucleotide-sugar transporter gene family.J Biochem (Tokyo). 1996 Dec;120(6):1074-8. PMID: 9010752 [PubMed - indexed for MEDLINE]

We described recently the molecular cloning of human UDP-galactose transporter 1 (hUGT1) [Miura, N. et al. (1996) J. Biochem. 120, 236-241]. Now we have characterized its isoform, hUGT2, that is most likely generated through the alternative splicing of a transcript derived from the UGT genomic gene, that also codes for hUGT1. Introduction of the open reading frame sequence of hUGT2 into a mouse cell line, Had-1, that lacks the UDP-galactose transporter, complemented the genetic defect of the mutant, as judged from the lectin-sensitivity spectra of the transformants and the nucleotide-sugar transporting activity of microsomal vesicles isolated from them. UGT-related genes were found through a BLAST search of dbEST based on their significant similarity with hUGT genes. We report here cDNA clones belonging to two subfamilies of the nucleotide-sugar transporter gene family. One is the human CMP-sialic acid transporter gene, and the other is a group of homologous genes with an undefined function that are distributed in man, mouse, and rat, and show significant similarity to the yeast UDP-N-acetylglucosamine transporter.

PubMed (9644260): Ishida N, Ito M, Yoshioka S, Sun-Wada GH, Kawakita M. Functional expression of human golgi CMP-sialic acid transporter in the Golgicomplex of a transporter-deficient Chinese hamster ovary cell mutant.J Biochem (Tokyo). 1998 Jul;124(1):171-8. PMID: 9644260 [PubMed - indexed for MEDLINE]

We recently described the cloning of putative human CMP-sialic acid transporter (hCST) cDNA [Ishida, N. et al. (1996) J. Biochem. 120, 1074-1078]. The hCST cDNA coded for a hydrophobic protein with an amino acid sequence showing a high degree of similarity (92% identity) to that of murine CMP-sialic acid transporter. In this report, we demonstrate that hCST corrects the CMP-sialic acid transporter-deficient phenotype of CHO-derived Lec2 cells, as judged from the recovery of WGA-sensitivity by transformants, and the recovery of CMP-sialic acid transporting ability by microsomal vesicles prepared from them. A peptide antibody against the C-terminus of the hCST protein detected the cDNA products expressed in the microsomes of the transformants. The subcellular localization of the hCST protein in the Golgi membrane was demonstrated by immunofluorescence microscopy, using the hCST-specific antibody. These results clearly indicate that hCST cDNA encodes the human CMP-sialic acid transporter protein. Plasma membrane-selective permeabilization combined with immunofluorescence microscopy provided strong evidence that the C-terminus of the human CMP-Sia transporter is exposed to the cytosol on the outer surface of the Golgi membrane.

>sp|P78382|S35A1_HUMAN CMP-sialic acid transporter OS=Homo sapiens GN=SLC35A1 PE=2 SV=1
MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSVGILAKETGSLGRFKASLREN
VLGSPKELLKLSVPSLVYAVQNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRTLSKLQWVSVFMLCAGVTLVQW
KPAQATKVVVEQNPLLGFGAIAIAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIIVTLAGVYLSDGAEIKEKGFFY
GYTYYVWFVIFLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTIASVMLFGLQITLTFALGTLLVCVSIYLYGLPRQDT
TSIQQGETASKERVIGV