TCDB is operated by the Saier Lab Bioinformatics Group
TRANSPORTERS FROM HUMANS:
Transporter Information:
Name: solute carrier family 35, member A4
Symbol: SLC35A4
TC: 2.A.7.12.1
Locations: 5q31.3
GenBank: AJ420598
Swiss-Prot: Q96G79
Accession Number: NM_080670
LocusLink113829
>sp|Q96G79|S35A4_HUMAN Probable UDP-sugar transporter protein SLC35A4 OS=Homo sapiens GN=SLC35A4 PE=2 SV=1
MSVEDGGMPGLGRPRQARWTLMLLLSTAMYGAHAPLLALCHVDGRVPFRPSSAVLLTELTKLLLCAFSLLVGWQAWPQGP
PPWRQAAPFALSALLYGANNNLVIYLQRYMDPSTYQVLSNLKIGSTAVLYCLCLRHRLSVRQGLALLLLMAAGACYAAGG
LQVPGNTLPSPPPAAAASPMPLHITPLGLLLLILYCLISGLSSVYTELLMKRQRLPLALQNLFLYTFGVLLNLGLHAGGG
SGPGLLEGFSGWAALVVLSQALNGLLMSAVMKHGSSITRLFVVSCSLVVNAVLSAVLLRLQLTAAFFLATLLIGLAMRLY
YGSR