TCDB is operated by the Saier Lab Bioinformatics Group
TRANSPORTERS FROM HUMANS:
Transporter Information:
Name: solute carrier family 35 (UDP-glucuronic acid/UDP-N-acetylgalactosamine dual transporter), member D1
Symbol: SLC35D1
TC: 2.A.7.15.2
Locations: 1p32-p31
Aliases: UGTREL7, KIAA0260
GenBank: AB044343
Swiss-Prot: Q9NTN3
Accession Number: NM_015139
LocusLink23169
PubMed (11322953): Muraoka M, Kawakita M, Ishida N. Molecular characterization of human UDP-glucuronicacid/UDP-N-acetylgalactosamine transporter, a novel nucleotide sugar transporterwith dual substrate specificity.FEBS Lett. 2001 Apr 20;495(1-2):87-93. PMID: 11322953 [PubMed - indexed for MEDLINE]

A novel human nucleotide sugar transporter (NST) which transports both UDP-glucuronic acid (UDP-GlcA) and UDP-N-acetylgalactosamine (UDP-GalNAc) has been identified, cloned and characterized. The strategy for the identification of the novel NST involved a search of the expressed sequence tags database for genes related to the human UDP-galactose transporter-related isozyme 1, followed by heterologous expression of a candidate gene (hUGTrel7) in Saccharomyces cerevisiae and biochemical analyses. Significantly more UDP-GlcA and UDP-GalNAc were translocated from the reaction medium into the lumen of microsomes prepared from the hUGTrel7-expressing yeast cells than into the control microsomes from cells not expressing hUGTrel7. The possibility that this transporter participates in glucuronidation and/or chondroitin sulfate biosynthesis is discussed.

>Q9NTN3|S35D1_HUMAN UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter - Homo sapiens (Human).
MAEVHRRQHARVKGEAPAKSSTLRDEEELGMASAETLTVFLKLLAAGFYGVSSFLIVVVNKSVLTNYRFPSSLCVGLGQM
VATVAVLWVGKALRVVKFPDLDRNVPRKTFPLPLLYFGNQITGLFSTKKLNLPMFTVLRRFSILFTMFAEGVLLKKTFSW
GIKMTVFAMIIGAFVAASSDLAFDLEGYAFILINDVLTAANGAYVKQKLDSKELGKYGLLYYNALFMILPTLAIAYFTGD
AQKAVEFEGWADTLFLLQFTLSCVMGFILMYATVLCTQYNSALTTTIVGCIKNILITYIGMVFGGDYIFTWTNFIGLNIS
IAGSLVYSYITFTEEQLSKQSEANNKLDIKGKGAV