TCDB is operated by the Saier Lab Bioinformatics Group
TRANSPORTERS FROM HUMANS:
Transporter Information:
Name: solute carrier family 6 (neurotransmitter transporter, betaine/GABA), member 12
Symbol: SLC6A12
TC: 2.A.22.3.1
Locations: 12p13
Aliases: BGT-1
GenBank: L42300
Swiss-Prot: P48065
Accession Number: NM_003044
GDBGDB:9767965
LocusLink6539
OMIM603080
PubMed (7589472): Rasola A, Galietta LJ, Barone V, Romeo G, Bagnasco S. Molecular cloning and functional characterization of a GABA/betaine transporterfrom human kidney.FEBS Lett. 1995 Oct 16;373(3):229-33. PMID: 7589472 [PubMed - indexed for MEDLINE]

The human homologue of the canine GABA/betaine transporter (BGT-1) was isolated from a kidney inner medulla cDNA library. The coding sequence predicts a 614 amino acids protein with the typical features of neurotransmitter transporter family. The gene maps to chromosome 12p13 and, in addition to kidney, is also expressed in brain, liver, heart, skeletal muscle, and placenta. Functional studies reveal a Km = 20 microM for GABA transport and a coupling to Na+ and Cl- with a stoichiometry 3 Na+:2 Cl-:1 GABA. At 500 microM the GABA transport was inhibited by various compounds with the following potency order: quinidine > verapamil > phloretin > betaine.

>sp|P48065|NTBE_HUMAN SODIUM- AND CHLORIDE-DEPENDENT BETAINE TRANSPORTER (NA+/CL- BETAINE/GABA TRANSPORTER) (BGT-1) - Homo sapiens (Human).
MDGKVAVQECGPPAVSWVPEEGEKLDQEDEDQVKDRGQWTNKMEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFIPYFI
FFFVCGIPVFFLEVALGQYTSQGSVTAWRKICPLFQGIGLASVVIESYLNVYYIIILAWALFYLFSSFTSELPWTTCNNF
WNTEHCTDFLNHSGAGTVTPFENFTSPVMEFWERRVLGITSGIHDLGSLRWELALCLLLAWVICYFCIWKGVKSTGKVVY
FTATFPYLMLVILLIRGVTLPGAYQGIIYYLKPDLFRLKDPQVWMDAGTQIFFSFAICQGCLTALGSYNKYHNNCYKDCI
ALCFLNSATSFVAGFVVFSILGFMSQEQGVPISEVAESGPGLAFIAFPKAVTMMPLSQLWSCLFFIMLIFLGLDSQFVCV
ECLVTASIDMFPRQLRKSGRRELLILTIAVMCYLIGLFLVTEGGMYIFQLFDYYASSGICLLFLSLFEVVCISWVYGADR
FYDNIEDMIGYRPWPLVKISWLFLTPGLCLATFLFSLSKYTPLKYNNVYVYPPWGYSIGWFLALSSMVCVPLFVVITLLK
TRGPFRKRLRQLITPDSSLPQPKQHPCLDGSAGRNFGPSPTREGLIAGEKETHL