TCDB is operated by the Saier Lab Bioinformatics Group
TRANSPORTERS FROM HUMANS:
Transporter Information:
Name: solute carrier family 7, (cationic amino acid transporter, y+ system) member 11
Symbol: SLC7A11
TC: 2.A.3.8.5
Locations: 4q28-q32
Aliases: xCT
GenBank: AB026891
Swiss-Prot: Q9UPY5
Accession Number: NM_014331
GDBGDB:10796632
LocusLink23657
OMIM607933
>sp|Q9UPY5|XCT_HUMAN Cystine/glutamate transporter OS=Homo sapiens GN=SLC7A11 PE=1 SV=1
MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSL
TIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEI
PELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFY
YGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVP
IFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFI
GLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIM
SEKITRTLQIILEVVPEEDKL