TCDB is operated by the Saier Lab Bioinformatics Group
TRANSPORTERS FROM HUMANS:
Transporter Information:
Name: solute carrier family 9 (sodium/hydrogen exchanger), isoform 3 regulatory factor 2
Symbol: SLC9A3R2
Locations: 16p13.3
Aliases: SIP-1, TKA-1, NHERF-2, E3KARP
GenBank: AF004900
Swiss-Prot: Q15599
Accession Number: NM_004785
GDBGDB:9956041
LocusLink9351
OMIM606553
PubMed (9054412): Poulat F, Barbara PS, Desclozeaux M, Soullier S, Moniot B, Bonneaud N,Boizet B, Berta P. The human testis determining factor SRY binds a nuclear factor containing PDZprotein interaction domains.J Biol Chem. 1997 Mar 14;272(11):7167-72. PMID: 9054412 [PubMed - indexed for MEDLINE]

The human Y-linked testis determining gene SRY encodes a protein with a DNA binding domain from the high mobility group box family. To date, no function has been assigned to amino acid sequences located outside this DNA binding motif. Here, we identify in a yeast two-hybrid screen a PDZ protein termed SIP-1, as an interacting protein with human SRY. In vitro, biochemical analysis, immunoprecipitation experiments, as well as expression of SIP-1 in human embryonic testis confirm that the two proteins can interact together. Interacting domains were mapped to the C-terminal seven amino acids of SRY and to the PDZ domains of SIP-1, respectively. We hypothesize that SIP-1 could connect SRY to other transcription factors providing SRY for its missing trans-regulation domain.

PubMed (9671706): Hall RA, Ostedgaard LS, Premont RT, Blitzer JT, Rahman N, Welsh MJ,Lefkowitz RJ. A C-terminal motif found in the beta2-adrenergic receptor, P2Y1 receptor andcystic fibrosis transmembrane conductance regulator determines binding to theNa+/H+ exchanger regulatory factor family of PDZ proteins.Proc Natl Acad Sci U S A. 1998 Jul 21;95(15):8496-501. PMID: 9671706 [PubMed - indexed for MEDLINE]

The Na+/H+ exchanger regulatory factor (NHERF) binds to the tail of the beta2-adrenergic receptor and plays a role in adrenergic regulation of Na+/H+ exchange. NHERF contains two PDZ domains, the first of which is required for its interaction with the beta2 receptor. Mutagenesis studies of the beta2 receptor tail revealed that the optimal C-terminal motif for binding to the first PDZ domain of NHERF is D-S/T-x-L, a motif distinct from those recognized by other PDZ domains. The first PDZ domain of NHERF-2, a protein that is 52% identical to NHERF and also known as E3KARP, SIP-1, and TKA-1, exhibits binding preferences very similar to those of the first PDZ domain of NHERF. The delineation of the preferred binding motif for the first PDZ domain of the NHERF family of proteins allows for predictions for other proteins that may interact with NHERF or NHERF-2. For example, as would be predicted from the beta2 receptor tail mutagenesis studies, NHERF binds to the tail of the purinergic P2Y1 receptor, a seven-transmembrane receptor with an intracellular C-terminal tail ending in D-T-S-L. NHERF also binds to the tail of the cystic fibrosis transmembrane conductance regulator, which ends in D-T-R-L. Because the preferred binding motif of the first PDZ domain of the NHERF family of proteins is found at the C termini of a variety of intracellular proteins, NHERF and NHERF-2 may be multifunctional adaptor proteins involved in many previously unsuspected aspects of intracellular signaling.

>sp|Q15599|NHRF2_HUMAN Na(+)/H(+) exchange regulatory cofactor NHE-RF2 OS=Homo sapiens GN=SLC9A3R2 PE=1 SV=2
MAAPEPLRPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGETHHQVVQRIKAVE
GQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQG
YGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVDPETDEHFKRLR
VTPTEEHVEGPLPSPVTNGTSPAQLNGGSACSSRSDLPGSDKDTEDGSAWKQDPFQESGLHLSPTAAEAKEKARAMRVNK
RAPQMDWNRKREIFSNF