TCDB is operated by the Saier Lab Bioinformatics Group
TCIDNameDomainKingdom/PhylumProtein(s)
*1.A.58.1.1









The Matrix protein BM2 (Pielak and Chou, 2010).  The solution structure for the channel domain of 33 aas is known (PDB# 2KIK) (Wang et al. 2009).  Transports H+ and K+ (Hyser and Estes 2015).

Viruses
Orthomyxoviridae
BM2 influenza virus type B
(P03493)
*1.A.58.1.2









Influenza Am2-Bm2 Chimeric Channel of 35 aas with 1 TMS. This hybrid sequence is RSNDSSDPLVVAASIIGILHFIAWTIGHLNQIKRG with the N-terminus derived from AM2 and the C-terminus derived from BM2 (PDB# 2KIK) (Pielak et al. 2011).
Bacteria
Chimeric AM2-BM2 35 aa peptide of A- and B-type Influenza viruses