TCDB is operated by the Saier Lab Bioinformatics Group

1.C.110 The Pore-forming PNC-27 Peptide of 32 aas from the p53 Tumor Suppressor Protein (PNC-27) Family

The 32 amino acid PNC-27 peptide (PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG) inserts into the membranes of tumor cells and selectively kills them, leaving normal cells unaffected.  This peptide is from the Mdm-2 binding domain of the p53 protein which is selectively cytotoxic to cancer cells.  The NMR structure is available (PDB# 1Q2F; 12QI-A).  The p53 cellular tumor antigen, p53-TAD, is 393 aas in humans and of similar sizes in other animals (Sookraj et al. 2010). 

References associated with 1.C.110 family:

Sookraj, K.A., W.B. Bowne, V. Adler, E. Sarafraz-Yazdi, J. Michl, and M.R. Pincus. (2010). The anti-cancer peptide, PNC-27, induces tumor cell lysis as the intact peptide. Cancer Chemother Pharmacol 66: 325-331. 20182728