TCDB is operated by the Saier Lab Bioinformatics Group
>pdb|6LH8|A Chain A, aerolysin-like protein
MSASVTVLWDKEIEGSNEVVKVDEMVASNISNVKVEFYLKERHFDRTITHNITLPRATEVPIGTEIQLEPKHRLNGNTEP
ITFTYGSLESYTELSEDKVTMPEFVEPKTKLIVILTRNENITSAPVEISVGDIKETATYICQSQSGINAEVNTEPL