TCDB is operated by the Saier Lab Bioinformatics Group
>gi|765198467|gb|AJR28539.1| hypothetical protein [Joinjakaka virus]
MGMLTGVSLEMFDIRDRFDQLINIFKEFKEKLEVYVNMLSSIFKQILFYILVIVAVMVILKLIIIVFKTAILVIKCYRVC
KCKKNKSVHVKRKKTSIISRIRQARLQRKTRLKTKLDL