TCDB is operated by the Saier Lab Bioinformatics Group
>gi|768404871|ref|XP_011598515.1| PREDICTED: BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like [Aquila chrysaetos canadensis]
MGARGRHVTGRAAGAERGCTRGAMACAGDDGSWVELRCGQGCLEPELVPSRFSSCHADVERMLLEAQLETESGDGALLAL
GSPAQEDDGAGQASEQPGESELLPPCSQPQLGCPHPWQRDVPEEAEQRERRLPASLSWVCAHHLQHLSPKEFAFVCSPQP
VLWSLQGGAVGRKKRLFSSELLLLFIPSLLLSHMLTLGLGIYIGKRLAASSANPL