TCDB is operated by the Saier Lab Bioinformatics Group
>sp|A0MFS9|CACLC_ARATH Anoctamin-like protein At1g73020 OS=Arabidopsis thaliana GN=At1g73020 PE=2 SV=1
MNGSNGEERVVHEVAMVVPKRVLEEEEGDCVEVLVTELRKKGMVVDRVVGLAHEFLKVAAPSEILGNAAAELHIRKPTRL
GIDLPFEMQGSEAFIRQPDGLLFSWFERFRCYQHLIYGIVNSGGHDVTLKLDGREFCWTAGESLLRRLESEGVIKQMFPL
HDELKRKELLQNWALNWWNCTNQPIDQIYSYFGAKIGVYFSFLGMYTQWLIFPALLGFIVQMVDFGSLQFLALPSFFVGT
ILWAALFLQFWKRKNAALLARWQINCLVGPSQGYRFLGMEWSSLPFPKELIKNLGNERAKEKEAYQRYEWFAYRKRFRND
VLVIMSIICLQLPFELAYAHIFEIITSDIIKYVLTAIYLLIIQYLTRLGGKVSVKLINREINESVEYRANSLIYKVFGLY
FMQTYIGIFYHVLLHRNFMTLRQVLIQRLIISQVFWTLMDGSLPYLKYSYRKYRARTKKKMEDGSSTGKIQIASRVEKEY
FKPTYSASIGVELEDGLFDDSLELALQFGMIMMFACAFPLAFALAAVSNVMEIRTNALKLLVTLRRPLPRAAATIGAWLN
IWQFLVVMSICTNSALLVCLYDQEGKWKIEPGLAAILIMEHVLLLLKFGLSRLVPEEPAWVRASRVKNVTQAQDMYCKQL
LRSISGEFNSLTKPEQEQQQDSERF