TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A0YQV7|A0YQV7_LYNSP Uncharacterized protein OS=Lyngbya sp. (strain PCC 8106) GN=L8106_28746 PE=4 SV=1
MTDKNKFRSLVALLLIWLFSGISDRLWFALDRSVPAWDQADYLTNSLNYWRALQHPQWFSSGWWEQVWMLSPKVPPLTYL
LTVPFYNLFGTGTTQGTLVHLLFSGIVLASVYGIAIQLFNRQIALWACIIAALLPGLYVYRLQYLIDYPITAMVALTFCC
LTQWKYSQKKWVWAIAFGVSFGLALFVKQTALFFLFVPLVWVSVDSLKHRRWKSLIQLTVALSLSILILIPWATTNWLLM
LTSGKRATLDSAIAEGDPALNTLDAWTYYWNLLPYHISWLWLIVPTVGFLLYLFYPKFLSKPINFSALRWLTVFWIGGYF
LCSLNINKDFRYSLPLLPISAIFLAYGLTLWPQRWGKIVRGITLSLAIVLMLLNLWPIGGVWGRRMAAFLSPGGDRIAYL
GLQWPHKQVINEIIQTEPYLQSTLGVLPSTPDINQHNLNYYGALRDEQVYGRQVGTRVEHVGQDSLSLSWFVTKTGQQGM
VKRINEAQFAIVREVEQGRQFQLQKRWLLPDNTVLNLYHRQTPYIEVSPQPDASEKVQLSQVIVSPKVPPNATIPIIYVW
SGSWEQLHSGLVILTWKLQTPATAITSSEWLHDHAIAMGTLHPGSLEKNQQKTGFQVLERMGMLPPKDILPGTYRLEATY
LNRESGETYPIAVPSVTVEIDPQAAKLPAPELDLVSQLRQLALNLPQGVPGLEPVFDQVGRINQYDPIQDYTVVAEKTLS
YRLQTAPENLDYAYALALATVLQQDAPTAIAALEQVTQLDPQNPNAYAYLAFIHLYALHPQAAEKAIQTAIKLNPDQSEF
QALRGISALMQGNLIQAWQDLQALR