TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A2CB33|A2CB33_PROM3 Putative uncharacterized protein OS=Prochlorococcus marinus (strain MIT 9303) GN=P9303_19511 PE=4 SV=1
MMRSFCFGLLRAMACLSLVASSLNAVRAEPREDRSELSPDVERLEVIAQPWLHDWLWLPEWIRLSFNYTNEIDANPSGGN
QQTGTYTHNVAINSAFSSGFGKEASEWQEIDHWTLNITASQRSGTSLSQKIPNELAVQQIYGYGQTFRLAGLWLERNQAE
DGLLKMKFGKFATFDDFASSPLYCFYTNNGFCGQNWGIPNSLPVMAYPANQYGFVFYLGEEDGPHVRSGTYQINPDGAEP
AFHGADFQIRDSDGLAQFVQFNVPLGSGKPQAARRLEDGSVVLVPEDELEVYYVSGLPQPGLQLGGWIGNWQFPLVNGNG
KTSESNEGVYGLVSVPWDFGGLVLDGRLWANATYGLTQSVQDVPNTYAGGWVGKGLFRNRPHDAVVIGLANVNWSRDIPD
GPIWESVLELGYQFMLGSNVSIQPGVQYIFNPMGKGDVDDPLLLGLQMSFSF