TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A2CDJ1|A2CDJ1_PROM3 Uncharacterized protein OS=Prochlorococcus marinus (strain MIT 9303) GN=P9303_28211 PE=4 SV=1
MHMPSWLHRVRSAEKAPFIFLFFVYFACSYRPLGSLIVDNILLKEDRLLESLSAIFLLSSSILLLLSARQAKSNRQFKNH
SSRLLILATAIFFWFAEEISWGRRILNFNVQFIEAINSQGDTTIHNLNFIQTYLHYAYFFVFTIVAILCIAPRKKSSAAF
NLLPSNKLFYYFFLPAIFYLIGQIMRDIPLEINGYTFERQYTHILQEAYEFLLALGVLKFSIEKFKTMSKINSLEPNPQK
QLNNQIDTSNL