TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A2DUD3|A2DUD3_TRIVA Mitochondrial carrier protein OS=Trichomonas vaginalis OX=5722 GN=TVAG_262210 PE=3 SV=1
MKPADKILIATSPSDAKLKPSDSFIAGFIAGIAARTASCPLDTVKMLMQTNSHKTSILETCREIIAKDGIKGFWRGNLVG
VINAAPLQAIKYTVIDHLQIYLKREYNSTPAERALVGAVAGVISQGVCYPFDLILTRTTVNPDRYHNLFHATKTIILEDG
ITGLWSGVFPTIVGAIVYEGSQFVVQGGFKQFYTQKEGRVATWRNLFIGACSGAVSQTIAFPFDVMRRRMMIVDSEGKRI
YNSYIGCFKSIWEKEGATGFFKGIHVNLFKILPNAAINYTVCEECKNLFLTYRAYQEAKQRNKK