TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A3CWV0|A3CWV0_METMJ Uncharacterized protein OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=Memar_1924 PE=1 SV=1
MQIRDWLPLLGMPLMLLFVQIIAIVLVMPMQAAGLVAFEDPESVANPLIFIGMLLAFTLVLLVLLRTGGRRFIAAFIGFA
LFMTFLYIFGALSLLALGPTTAAAAGTLIGAVAVTALLYLYPEWYVIDILGVLISAGVASIFGISLAVLPVLVLLVLLAV
YDAISVYRTKHMITLAEGVLETKAPIMVVVPKRADYSFRKEGLNISEGEERGAFVMGMGDLIMPSILVASSHVFVDAPAV
LWTLSAPTLGAMVGSLVGLAVLLYFVNKGNPQAGLPPLNGGAILGFLVGAALAGSFSWLPF