TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A3CXC7|A3CXC7_METMJ Chloride channel protein EriC-like protein OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=Memar_2102 PE=4 SV=1
MPAPADGPAPPEERICVEPGSREGTPNLRQVALIAVIAILFTVAYLALYGLLNNVVWSQNNFVQANPWAVPAGVLAFSLL
VGLCRRYLHAPDVIHGGFAESLRGGGEKPNYRTFPGALLSSLFSLLSGASIGPEGTITVLIGYVSSYVRDRLRIGSPGAA
LGFDVAALASAFNGIVGNVLFTGVFATEFQIGGNRNAFRFLTWNLLAGTVGYLFYLLLGLPSFARSIPFEPIGELHPGYI
LCAIALGILGSLLAVFAGGAMQAAGTVMDRIFGDAPVARVLAAGAVIACVGYFIPEVLFSGEAQIHGIIADPARLGVGML
LGVAVLKILLLALSFKSGYIGGPLFPIIFSSTLIGLALNLAFPGIPLGIFVLCIEVAALTLALGAPLTSILLVAVVGTAD
QYTVVLLVISAVTAMVIAAAVKERMGGQP