TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A4A3U6|A4A3U6_9GAMM Uncharacterized protein OS=Congregibacter litoralis KT71 GN=KT71_16906 PE=4 SV=2
MKTNNRQQGMGMLGMLIIAVMVGFFVMSGIRIAPGLIEYQTVRELVIEAAEEFDDEEDTIADIRRQLSGSFNMNQIKSIG
PRDVDITRENGKVVLNANYEDRIPLFWRIDAVVKYDDLVFIAGERYSDD