TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A4S072|A4S072_OSTLU Uncharacterized protein OS=Ostreococcus lucimarinus (strain CCE9901) OX=436017 GN=OSTLU_32638 PE=4 SV=1
MVGLSYTTQKSVVIRSWRLGALYYAIVGVVLSYVGWYLVYLKHGYQLRSQAVGNIGLKIKGQAVLRDAATGLETVYDAND
LVIYEPSGFFVATALMTTLQARGRCPGMDDDEACTEDASICRAGAFSASGRMTGACVDAGGSSGEKRCEIEGWCPGEPED
DRVNVLENVGNFTVFTRISVEFPGIPNKKGDGNLLWTNLNGTEPTMGWNLWTLNDLLASGGMRVEDIAKKGWDGRLDVQF
DCDLDRGIESCAPKTPYKVRQVTDSEINTLSKGYNIRWVSAHNVGEPAPMQGVTYNQTGNSKDVRLLVKGYGPRIRFAVD
GVGRKFDVLALSTTVGAGVAFLGIASLVVNAVMMYGSGKKSKQYENWLFAEFNDDSYGATENNS