TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A4TZ39|A4TZ39_9PROT Protein, required for colicin V production OS=Magnetospirillum gryphiswaldense GN=MGR_2272 PE=4 SV=1
MGNLSITAVDIVVAVVLLGSAGFAFMRGFVHEVLAIAAWVGAALAALYGFQYVQPLARQYIGSALVADIAAGAALFLVTL
LVLSMITKAAADRVRRSALNSVDSSLGFAFGLVRGALLVSLAHLLITMITETPPSWLAEARSYPWLERGATMLRALAPDN
FGTTQGQARQMSKEAQDLMQAEQTLRKYIAPQPAAPAAKEVETGAKPAQGYDKESRSQLDRLIQANQ