TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A5K427|A5K427_PLAVS Translocation protein sec62, putative OS=Plasmodium vivax (strain Salvador I) GN=PVX_118580 PE=4 SV=1
MSRSEDLDPDMLALLTCAFDEGVKVKGAVEVGKRAVEYFRGDEFVHFLYTRRDMLKKKFPTLLQNRTLADLKDIEEFSDT
FIQKGFIYKAQYKPIKGINEIDENGMYRRPKWPRRLIMSSKQNFDRTSFYILVHERNKKLQYLMLITLISIVLICCMFPI
WPLRLKLALWHLSVVFISLMSVIVLIRLFLFIFFWFFGVDYWLFPNLFDEECNVVESFTPVHQWIYRNDTWLLVIARMFT
AVLLAIGIHQLGKTHSISDIGNFATQSFIDIIEWGNKKLAASPENVSMYKSLDSKATFEVEFQDDGVVYDENEENYDCLK
GCGFQTFEELVRKCFLKCECMEKVIKSECYKKKCSRVTKEVLDEAHKEACFGKKDK