TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A6C291|A6C291_9PLAN Putative uncharacterized protein OS=Planctomyces maris DSM 8797 GN=PM8797T_03109 PE=4 SV=1
MEPRDENYRKDQLFQRIPFEIFHAHRFEKKLHNLRTSLIFKSIWCSICIVSLVISTRSTFADDAIPESLPEEPRVEKPAY
EQTCSSCECSGPDFWNQTTLTENLFQRRPYLAEQGITFEADVTQFYMGVASGGEEQDFRYAGHGDYVLNLDSGKLGGPQG
LFVKLRAEHRFGEGITDATGAIIPVNLVADLPVADSTELYLTNVLFTQMFSESFGVFAGKMDTLDGDMNAFAHGRGKTQF
SNAAFVATPIGLRTIVYSSLGTGFLIMREGEPIFTFTVINSTDTSGTSGFKELFANGASVIPELRLPTNLFGRPGHFLFG
ASWSSRDYAALEQDPFIVLPDIPISRKTDSWSLYWNFDQYLFVDPCDATRGWGVFGRAGIADAETNPIEWFLSFGVGGNS
PISSREADTFGVGWYYSATSDRLSPFINTILGGVGDGYGVEMFYNIEVNKWFHLTADMQVIRPAHETVDTALVVGLRAVI
DL