TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A6DDW9|A6DDW9_9PROT Putative uncharacterized protein OS=Caminibacter mediatlanticus TB-2 GN=CMTB2_06381 PE=4 SV=1
MLKKLSLAAIIAVSGVSFASATPLTDAIKNVDVSGKLDIEYTGTKRTSYTSEWTIDTEAKFTVPISEELKFIFNAKAKGV
DEKVNFNQTEGYVNYTSANGYFVNFGKFALKTPITDDAISQGVLAGTKVNNVTLVGAFLDKTYDTDKVTVDDKNIYAVGA
IIPTEYVNFQAWYFNVNDTINSDVVLRADIKPIENILLHADYATADLNDRLNNSKTQTYYNVSAKVSYENYCAKVGYAAT
GKDGGIVTLEHDSPLTKVSPTENLQDIANSTDTTLTYAKIGAKIGAYTPYAGFAYRNDKVNKDKDTEYKVGVNYQYNKKT
TISAYYNYFNNENAEQKYDVEFTYKF