TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A6WUW2|A6WUW2_OCHA4 Uncharacterized protein OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=Oant_0035 PE=4 SV=1
MVAACSAYAAVNVATQWAGTRTGIPSVIIAFWQYVIALVLTLPLLVRDGTRALRTSHFGLHVMRVALAAAGVQVWIYALT
HVPIWQVVALSMTSPFFVILCARLFLQEKVTPARLLTTFTGFIGALIIIAPWSDSYTVYSLLPILAAALWAGYSVMTKYL
TRFEKPASISAYMLVLLTPINAALWLASGLSMSAITAPDVEIWSILIVIGAFTALAQYFQTAAYSIADAVYLQPFDDLRL
PINVIFGWIVFAAAPSINFWPGAALIIGASLYLMRQDSGTSRTA