TCDB is operated by the Saier Lab Bioinformatics Group
>A6XWX0|A6XWX0_VIBCH ComEC/rec2 family protein - Vibrio cholerae AM-19226.
MAYGIMTLLSNYWSLISFSITVLSAPYWPWMPSWGWAWLCLIVMVLLGYHRVGRQFLGFVAAILTIVLQGNLIRDQSNVL
YQAGPDIIIKGRVDSFFTQTRYAYEGFVLIHEVNGQTLNKMTRPRIRLSAPLLLQPNDRVEFSVTLKPIVGRLNQTGFDL
EAHYMAQSVVARAVVKPDTAYQIVQESGIRSSLFFELEQLTHTSPYQGLILALTFGERKGIDEQEWQALRNSGLIHLVAI
SGLHIGIAFSVGYFLGLGMMRLHAQLLWSPFVCGALLAVLYAWLAGFTLPTQRALIMCLLNVALIMLAFPLSALKRILLT
LVAVLLWSPFASLSNSFWMSFLAVAIVLYQLASQSQRQVWWKALLWAQVFLVCLMAPVTAYFFGGLSVTAVLYNLVFIPW
FSLVIVPALFLGLLLMVVWPSVAAAYWPWVDWTFLPLDWALQFADVGWWVVPSKVQGVVAASVAILLLYRFMSLKACSLL
LGMIGLWWWFPSLTPLWRMDVLDVGHGLAIVIEQDERAIVYDTGSSWPGGSYVQSVIEPMLQQRGLRQVDGVILSHLDND
HAGDWQGLAERWQPNWIRASQLGTEFMPCIRGESWQWQSLHFAVLWPPQAVSRAYNQHSCVIRMTDTQSNHSVLLSGDVT
AMGEWLLARDGAQLRSEVMIVPHHGSKTSSTAEFIAQVNPKLAIASVAKDNRWNLPNPQVVARYQAQQVEWLDTGQAGQI
SLFFYPDQLDWFTQRSLGWQPWYRQMLRKGVE