TCDB is operated by the Saier Lab Bioinformatics Group
>tr|A7E3G5|A7E3G5_BOMMO Odorant receptor 22 (Fragment) OS=Bombyx mori GN=Or22 PE=2 SV=1
MNKNMNKNHYILKTYCDKIFLVGSGNFWYQKTESRNDKTLLYKIYSCVLFFTYGFMTVLEIMAATMGDFPDDEKRDSVTF
ASSHTLIMIKFISIIKNKELLKTLNRKMMMICEAHEEQTLMDEMYRIVKINVVAYCVAVYGSVTFFVFEGLRKFYDGSHF
VTIVTYYPSKDDDTMLASIFRIATTLVLLVMMLSMIISVDTYTMAYLIMYKYKFITLRHYFKRLRENVDELVAAGKARLA
AEKLAQGLVEGIKMHNELLSLSKDIHKAFGTVMALQLCQSSGSAVSLLLQIAVTMYLLLALFLCNAGEITYQ